PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PEQU_30666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
Family CAMTA
Protein Properties Length: 181aa    MW: 20763.5 Da    PI: 4.2533
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PEQU_30666genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-134.83e-1111715175109
        CG-1  75 vggvevlycyYahseenptfqrrcywlLeeeleki 109
                 +g+ e +++yYa++e++p+f rrcywlL++ +++ 
  PEQU_30666 117 IGNEERIHVYYARGEDDPNFYRRCYWLLDKWKKRL 151
                 7899*************************986655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143711.092113176IPR005559CG-1 DNA-binding domain
PfamPF038592.5E-7117147IPR005559CG-1 DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MISFTDYEAC EKLNSDPRED DFIYDYQLFA DDIEIIIILD DPTRKNPTGL AEATLEDSDS  60
EVMGFQVEIE LIGAFNIFST IKRDLTTAGP PPESILLPQR LYPMDWVVLR FYLSSEIGNE  120
ERIHVYYARG EDDPNFYRRC YWLLDKWKKR LTTTSSIEKA CSVLLAAGDV GEVRAKCVKG  180
P
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.13e-13calmodulin binding;transcription regulators